J
JustmarketsEngineering

PHP/WordPress Engineer

Europeonsitemid

via Greenhouse

About this role

We are inviting you, a highly motivated and results-oriented PHP/WordPress Engineer to join our team for ensuring solutions, as well as strengthening the product. Our team has unique expertise in research, analysis, and product development. By relying on technical insights and a data-driven approach, we create disruptive future-defining innovations of the fin-tech industry that remain our basis for success. Responsibilities Developing and maintaining full-stack PHP/WordPress solutions using the Roots ecosystem (Bedrock, Acorn, Sage) Building and supporting custom plugins and themes Developing and maintaining ACF Gutenberg Blocks Implementing pixel-perfect, responsive layouts using Blade, SCSS, and JavaScript Designing and integrating REST APIs and third-party services…

Read the full description on Justmarkets's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, laravel, rest…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Europe. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmllaravelrestmysqlbedrockgitgitlab

More at Justmarkets

See all open jobs at Justmarkets