Senior WordPress Developer (Remote)
Torontoremotesenior
Posted 1mo ago · via Recruitee
About this role
About Jumpfactor 8-time Growth500 agency driving $1.6B+ in MSP and B2B tech revenue. Fast-paced, performance-driven, and built for high-quality digital execution. The Role Build, maintain, and optimize WordPress websites by translating designs into scalable, responsive, and high-performance builds with custom functionality and integrations.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, html, css, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphphtmlcssmysqlawsgitteamshubspot
More at Jumpfactor
- View →Outbound & Automations Manager (Remote)Toronto, Canada
- View →Senior Digital Marketing Account Manager (Remote)Toronto, Canada
- View →GoHighLevel (GHL) Automation Specialist (Remote)Toronto, Canada
- View →Full Stack Developer, Automation & Internal Tools (Remote)Toronto, Canada
- View →Senior AI Content Strategist (Remote)Toronto, Canada
- View →Digital Agency Operations Director (Remote)Toronto, Canada
