Cloud Engineer

Jakartaonsitemid

Posted 1mo ago · via Workday

About this role

Why choose iZeno? iZeno was founded in 2003 to provide enterprises with custom-built technology solutions they need to keep their business running seamlessly. Logicalis Asia, part of the Logicalis Group, a leading international IT solutions and managed services provider, has acquired a majority stake in iZeno , a company specialising in digital transformation, application modernisation, DevOps, customer experience and hybrid cloud solutions. With a team of 120+ in-house innovators, we have delivered over 500 Enterprise Solutions, implemented, and optimized to enable smarter insights.…

Read the full description on iZeno Thailand's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: shell, bash, postgresql, cassandra, aws…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Jakarta. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

shellbashpostgresqlcassandraawsgcpgrafanakafka

More at iZeno Thailand

See all open jobs at iZeno Thailand