AI & Software Solutions Architect (Remote, Contract)
Ukraineonsite
via Greenhouse
About this role
OUR HIRING PROCESS:
We will review your application against our job requirements. We do not employ machine learning technologies during this phase as we believe every human deserves attention from another human. We do not think machines can evaluate your application quite like our seasoned recruiting professionals—every person is unique. We promise to give your candidacy a fair and detailed assessment.
We may then invite you to submit a video interview for the review of the hiring manager. This video interview is often followed by a test or short project that allows us to determine whether you will be a good fit for the team.
At this point, we will invite you to interview with our hiring manager and/or the interview team.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, php, sql, elasticsearch, aws…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Ukraine. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonphpsqlelasticsearchawskafkarabbitmqclaudeteamszoom
More at Infuse
- View →Middle Project ManagerKyiv, Odesa, Kharkiv, Lviv
- View →Senior Product Manager– Internal Processes (Contract, Remote)Serbia
- View →Creatives Delivery AssociateBaku, Baku, Azerbaijan
- View →Middle IT Project Manager (Contract, Remote)Kyiv, Odesa, Lviv, Kharkiv
- View →AI Transformation Specialist (Remote, Contract)Georgia
- View →Creatives Delivery AssociateKryvyi Rih, Dnipropetrovs'k, Ukraine
