Ingénieur ML/LLM - Paris - H/F

Parishybrid

Posted 2mo ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About Chez Free, tu trouveras unea0 culture interne singulière a0et très marquée. Il règne un fort état d’esprit collectif. Le recrutement est ouvert, sans a priori : on ne juge les gens ni sur leur âge, ni sur leur background. On aime aller vite, faire les choses nous-mêmes, et on mise sur l’autonomie pour être efficace. Tu verras : chez Free, on se senta0 librea0! Tu veux plonger au cœur d’un projet ambitieux mêlant intelligence artificielle, LLMs et innovation concrète ? Rejoins l’équipe dataX d’Iliad-Free, et participe au développement d’un assistant conversationnel augmenté , conçu pour accompagner – et non remplacer – nos agents du support technique.…

Read the full description on Iliad Free's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, r, vite, aws, gcp…

Level fit

We check your title trajectory against the seniority signal of the role.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Paris. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonrviteawsgcppandasscikit-learnpytorchtensorflowtransformersmlflow

More at Iliad Free

See all open jobs at Iliad Free →