Ingénieur ML/LLM - Paris - H/F
Parishybrid
Posted 2mo ago · via Smartrecruiters
About this role
About Chez Free, tu trouveras unea0 culture interne singulière a0et très marquée. Il règne un fort état d’esprit collectif. Le recrutement est ouvert, sans a priori : on ne juge les gens ni sur leur âge, ni sur leur background. On aime aller vite, faire les choses nous-mêmes, et on mise sur l’autonomie pour être efficace. Tu verras : chez Free, on se senta0 librea0! Tu veux plonger au cœur d’un projet ambitieux mêlant intelligence artificielle, LLMs et innovation concrète ? Rejoins l’équipe dataX d’Iliad-Free, et participe au développement d’un assistant conversationnel augmenté , conçu pour accompagner – et non remplacer – nos agents du support technique.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, r, vite, aws, gcp…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Paris. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonrviteawsgcppandasscikit-learnpytorchtensorflowtransformersmlflow
More at Iliad Free
- View →Conseiller en boutique - La Défense - Les 4 Temps - Renfort ÉtéPuteaux, IDF, France
- View →Senior Développeur Fullstack - Python/React-Next.JS - H/FParis, IDF, France
- View →Conseiller en boutique - BesançonBesançon, Bourgogne-Franche-Comté, France
- View →Manager boutique - Mâcon - h/fMâcon, Bourgogne-Franche-Comté, France
- View →Manager boutique - ClusesCluses, Auvergne-Rhône-Alpes, France
- View →Conseiller en boutique - Annecy Epagny - CDD 4 MoisEpagny, Auvergne-Rhône-Alpes, France
