UXUI Designer (Tech/ Web3)

Vietnamonsitemid

via Greenhouse

About this role

We are hiring for one of our ecosystem projects. The company is Asia's leading web3 venture studio. They are a global team of researchers, engineers, designers, operators, and crypto veterans #BUIDLing the next digital economy. They are firm believers in the ethos and paradigm shifting potential of crypto. Their portfolio companies and advisory clients benefit from their long term and hands-on approach, from concept to full fledged venture. We are looking for an UXUI Designer to join their team. You will be responsible for designing and developing user interfaces and frontend components for their projects. If you are passionate and enthusiastic about the web3 industry, come and join our team! In this role, you will:…

Read the full description on Hyphenconnect's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, html, css, figma, sketch…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Vietnam. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssfigmasketchinvisionteams

More at Hyphenconnect

See all open jobs at Hyphenconnect