UXUI Designer (Tech/ Web3)
Vietnamonsitemid
via Greenhouse
About this role
We are hiring for one of our ecosystem projects. The company is Asia's leading web3 venture studio.
They are a global team of researchers, engineers, designers, operators, and crypto veterans #BUIDLing the next digital economy. They are firm believers in the ethos and paradigm shifting potential of crypto. Their portfolio companies and advisory clients benefit from their long term and hands-on approach, from concept to full fledged venture.
We are looking for an UXUI Designer to join their team. You will be responsible for designing and developing user interfaces and frontend components for their projects.
If you are passionate and enthusiastic about the web3 industry, come and join our team!
In this role, you will:…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, figma, sketch…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Vietnam. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssfigmasketchinvisionteams
