UXUI Designer
Vietnamonsitemid
via Greenhouse
About this role
Our Client is a high-performance data indexing and visualization platform designed to provide users with unmatched query speed and intuitive visualization at an efficient cost. They leverage its superior dataset organization methodologies and exploit data parallelism through GPU acceleration and decentralized computing to achieve both speed and efficiency.
We are looking for an UXUI Designer to join their team. You will be responsible for designing and developing user interfaces and frontend components for their projects.
In this role, you will:
Responsible for the design process, from concept development to final implementation, for our digital products.
Conduct user research and gather insights to inform design decisions and validate user needs.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, figma, sketch…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Vietnam. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssfigmasketchinvisionteams