Senior Digital Product Designer
San Franciscoonsitesenior$170K – $250K
via Greenhouse
About this role
Who We Are
HP IQ is HP’s new AI innovation lab. Combining startup agility with HP’s global scale, we’re building intelligent technologies that redefine how the world works, creates, and collaborates.
We’re assembling a diverse, world-class team—engineers, designers, researchers, and product minds—focused on creating an intelligent ecosystem across HP’s portfolio. Together, we’re developing intuitive, adaptive solutions that spark creativity, boost productivity, and make collaboration seamless.
We create breakthrough solutions that make complex tasks feel effortless, teamwork more natural, and ideas more impactful—always with a human-centric mindset.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, react, spark, figma, sketch…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in San Francisco. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptreactsparkfigmasketchteams
More at Hpiq
- View →Lead AI-Native Digital Product DesignerSan Francisco, CA
- View →Lead Machine Learning Engineer, Recommender SystemsPalo Alto, CA
- View →Senior Antenna EngineerSan Francisco, CA
- View →Senior Machine Learning Engineer, Recommender SystemsPalo Alto, CA
- View →Senior Product Design EngineerSan Francisco, CA
- View →General InterestSan Francisco, CA
