H
HospitableEngineering

Senior Front-End, Angular, Product Engineer (Remote)

Remoteremotesenior$134K$167K

Posted 2mo ago · via Workable

About this role

tldr; We build software for Airbnbs to rent themselves, with a state-of-the-art product and user experience. We have crafted an Applicant Handbook, which we highly recommend you check out, where you can find out more about the company, culture, how we recruit, what we do, and how we do it: https://hsptb.com/hndbk We believe in the value of team diversity and seek candidates from a wide range of backgrounds in their work, life, culture, and experiences. We are bold, like risks, and take on big challenges together. Our customers love the product, provide valuable feedback, and trust us to rapidly help them with more of their problems.…

Read the full description on Hospitable's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: php, angular, ionic, laravel, mysql…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

phpangularioniclaravelmysqlsentryslackteamsposthog

More at Hospitable

See all open jobs at Hospitable