Senior Front-End, Angular, Product Engineer (Remote)
Remoteremotesenior$134K – $167K
Posted 2mo ago · via Workable
About this role
tldr; We build software for Airbnbs to rent themselves, with a state-of-the-art product and user experience. We have crafted an Applicant Handbook, which we highly recommend you check out, where you can find out more about the company, culture, how we recruit, what we do, and how we do it: https://hsptb.com/hndbk We believe in the value of team diversity and seek candidates from a wide range of backgrounds in their work, life, culture, and experiences. We are bold, like risks, and take on big challenges together. Our customers love the product, provide valuable feedback, and trust us to rapidly help them with more of their problems.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: php, angular, ionic, laravel, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
phpangularioniclaravelmysqlsentryslackteamsposthog
More at Hospitable
- View →Senior Accountant (US EST/EMEA - Remote)Netherlands
- View →Senior Compliance Officer (US EST/EMEA - Remote)Remote, Oregon, United States
- View →Customer Support Advocate (North America - Remote)Remote, Oregon, United States
- View →Staff Product Marketing Manager (USA/EMEA - Remote)Remote, Oregon, United States
- View →Staff Customer Support Advocate (North America - Remote)Remote, Oregon, United States
- View →Staff UI/UX Product Designer (USA/EMEA - Remote)Remote, Oregon, United States
