GrvtySpace Intelligence Business Unit - Granite

Data Science Software Engineer

Laurelonsitemid

via Greenhouse

See if I'm a fit →Tailor my resume for this role →Apply on Greenhouse ↗

About this role

What You'll be Owning GRVTY is seeking a with a TS/SCI + Poly clearance (applicable to this customer) to join one of our top projects in . The Data Science Software Engineer shall develop, enhance, and prototype compliance and business processing analytics and tools. They will also develop new methods for automating compliance functions and improve existing methods. Additionally, the Engineer will investigate, integrate, and test compliance modernization Machine Learning/AI algorithms and research proof-of-concepts in the RD environment. Lastly, the Engineer will develop models and implement appropriate metrics and monitoring of developed tools, functions, and data flows. What You Must Have Active TS/SCI with Polygraph Clearance…

Read the full description on Grvty's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, scala, sql, aws…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Laurel. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavascalasqlawssparkscikit-learngitlabbitbucketjiraconfluencejson

More at Grvty

See all open jobs at Grvty →