Salesforce Architect
Bostononsite$10K – $25K
Posted 109mo ago · via Smartrecruiters
About this role
About Dellfor Technologies is founded by software professionals with fresh approach, and ideas empowering clients and partners in meeting the unique challenges created by transforming business needs. Our technical, domain expertise across obust solutions. We strive to prove ourselves from project inception through completion... Our technical, domain expertise across industries and process oriented approach enables clients to develop cost effective and robust solutions. We strive to prove ourselves from project inception through completion... To succeed in the Dellfor technologies, you need exceptional connections - to the right experts, the right opportunities and the right answers.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, sql, html, mysql, teams…
2
Level fit
We check your title trajectory against the seniority signal of the role.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Boston. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptsqlhtmlmysqlteamssalesforcexml
More at Dellfortechnologies
- View →AWS Cloud ConsultantJacksonville, FL, United States
- View →AWS Cloud ConsultantWashington, DC, United States
- View →AWS Cloud ConsultantNew Orleans, LA, United States
- View →AWS Cloud ConsultantBoston, MA, United States
- View →AWS Cloud ConsultantJersey City, NJ, United States
- View →AWS Cloud ConsultantMaryland City, MD, United States
