D
DellfortechnologiesInformation Technology

Salesforce Architect

Milwaukeeonsite$10K$25K

Posted 109mo ago · via Smartrecruiters

About this role

About Dellfor Technologies is founded by software professionals with fresh approach, and ideas empowering clients and partners in meeting the unique challenges created by transforming business needs. Our technical, domain expertise across obust solutions. We strive to prove ourselves from project inception through completion... Our technical, domain expertise across industries and process oriented approach enables clients to develop cost effective and robust solutions. We strive to prove ourselves from project inception through completion... To succeed in the Dellfor technologies, you need exceptional connections - to the right experts, the right opportunities and the right answers.…

Read the full description on Dellfortechnologies's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, sql, html, mysql, teams…

2

Level fit

We check your title trajectory against the seniority signal of the role.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Milwaukee. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptsqlhtmlmysqlteamssalesforcexml

More at Dellfortechnologies

See all open jobs at Dellfortechnologies