Software Engineer - IAM Team
Bengaluruonsitemid
via Greenhouse
About this role
Software Engineer - IAM Team
Software Engineer [P2]
Job Description: Software Engineer - Full Stack (BE Primary)
Role: Software Engineer - Account Management & Customer Support
Location: Bangalore, India
DAT is looking for a self-driven, passionate, and experienced Software Engineer to join our Account Management & Customer Support domain team within our Identity & Access Management (IAM) umbrella in Bangalore, India.
At DAT, our leaders optimistically share future possibilities to inspire and motivate others toward their full potential. We expect our employees to find ways to embrace positive change, be curious, challenge the status quo, and provide solutions to unmet problems.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, java, angular, node.js…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Bengaluru. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptjavaangularnode.jsgraphqlpostgresqlmysqlawsgcpfargateiamkubernetesdockerterraformserverlesskafkaclaudegithubteams
More at Datsolutions
- View →Key Account ManagerMississauga, Ontario
- View →Carrier Risk CoordinatorSeattle, Washington, United States
- View →Senior Manager, Event MarketingDenver, CO, USA; Seattle, Washington, United States
- View →Broker Sales RepresentativeRemote - USA
- View →Agentic Business Intelligence ManagerSeattle, Washington, United States
- View →Senior Software Engineer - IAM TeamBengaluru, Karnataka, India
