Senior Full-Stack Engineer (WordPress)
Sao Pauloremotesenior
Posted 11mo ago · via Recruitee
About this role
We are looking for a highly skilled developer that has experience in building websites using the WordPress framework. Candidates should have experience dealing with standard and custom theme development, plugin selection, plugin development, security, performance, mobile-first design, and custom integrations. Must be able to work EDT business hours. 8am - 5pm New York time. Must be dedicated, passionate and hard-working. Attitude is everything. Must be able to work with a team and collaborate remotely. Hard workers and self-starters please apply.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, html, css, less…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphphtmlcsslessnext.jsjqueryrestnetlifyfigmasketchinvision
More at Curotec
- View →Mobile Lead Engineer (React Native) - US-basedSão Paulo, Brazil
- View →Senior Cloud Platform EngineerSão Paulo, Brazil
- View →Senior iOS Engineer (w. Swift)Sao Paulo, Brazil
- View →Senior Android Engineer (w. Kotlin)Sao Paulo, Brazil
- View →Senior Full-Stack Engineer (AI/LLM-focused)Buenos Aires, Argentina
- View →Associate Director of Account ManagementPhiladelphia, United States
