C
CurotecTechnology

Senior Full-Stack Engineer (WordPress)

Sao Pauloremotesenior

Posted 11mo ago · via Recruitee

About this role

We are looking for a highly skilled developer that has experience in building websites using the WordPress framework. Candidates should have experience dealing with standard and custom theme development, plugin selection, plugin development, security, performance, mobile-first design, and custom integrations. Must be able to work EDT business hours. 8am - 5pm New York time. Must be dedicated, passionate and hard-working. Attitude is everything. Must be able to work with a team and collaborate remotely. Hard workers and self-starters please apply.…

Read the full description on Curotec's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, html, css, less…

2

Level fit

This role is senior-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphphtmlcsslessnext.jsjqueryrestnetlifyfigmasketchinvision

More at Curotec

See all open jobs at Curotec