Cti MdDEV04 - Tech SIGINT

Systems Engineer (DevOps) - multiple levels - FULLY CLEARED with POLYGRAPH REQUIRED

Columbiaonsitemid

Posted 11mo ago · via Lever

See if I'm a fit →Tailor my resume for this role →Apply on Lever ↗

About this role

RHEL 617/8, RHCSNRHCE CentOS, Confluence / Jira, Python, Ruby, Perl, Java, DevOps, Site Reliability Engineering, Software Defined Networking, deployment architecture, SLA requirements, Configuration Management, containerization, serverless technologies, Kubernetes, Gradle, Maven, ANT, Shell, Jenkins, Docker, Bamboo, Amazon Web Services, VMWare, Puppet, Chef, ansible, Memcache, Active MQ, Redis, APC, MySQL (Clusters, Replication, and Tuning), Elasticsearch, Kibana Due to federal contract requirements, United States citizenship and an active TS/SCI security clearance and polygraph are required for the position.

Read the full description on Cti Md's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, ruby, perl, shell…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Columbia. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavarubyperlshellmysqlrediselasticsearchkubernetesdockeransiblepuppetchefserverlessjenkinsjiraconfluencegradlemaven

More at Cti Md

See all open jobs at Cti Md →