Staff Data Scientist
Hyderabadonsitestaff$46K – $420K
via Greenhouse
About this role
Opportunity Overview:
As a Staff Data Scientist at Cohere Health, you will serve as a technical leader across high-priority initiatives, shaping how data science is applied to some of the most complex challenges in healthcare. You’ll drive the design of advanced analytical and modeling solutions, influence strategic direction, and partner deeply across Product, Clinical, and Engineering to deliver scalable, high-impact outcomes.
This role goes beyond execution. You’ll define approaches, set standards, and guide others in solving ambiguous, high-leverage problems. You’ll play a critical role in advancing the maturity of data science at Cohere while contributing directly to improving clinical and operational decision-making.
What you’ll do:…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, elasticsearch, aws, emr, spark…
2
Level fit
This role is staff-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Hyderabad. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonelasticsearchawsemrsparkpysparktransformerscohereteams
More at Coherehealth
- View →Healthcare Analyst IIUnited States
- View →Clinical Review & Correspondence RNUnited States
- View →Staff Machine Learning EngineerHyderabad, Telangana, India
- View →Operations Executive AssistantHyderabad, Telangana, India
- View →Payment Training ManagerUnited States
- View →Senior Machine Learning EngineerUnited States