Software Engineer, Machine Learning Platform
San Franciscoonsitemid
via Greenhouse
About this role
About the role
Chime’s Machine Learning Platform (MLP) team builds and operates the infrastructure, tooling, and developer experience that powers machine learning across the company. We enable data scientists and ML engineers to develop, train, deploy, and monitor models reliably and efficiently.
As a Machine Learning Platform Engineer, you will design and build scalable systems that support model training, feature computation, real-time inference, and experimentation. You’ll work at the intersection of distributed systems, cloud infrastructure, and applied machine learning.
This role focuses on building robust foundations that allow ML teams to move quickly while maintaining reliability, governance, and cost efficiency.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, go, scala, aws…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in San Francisco. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavagoscalaawskinesiscloudformationkubernetesdockerterraformsparkkafkaflinkrayteamsmaven
More at Chime
- View →Principal Product Designer, SpendingSan Francisco, CA, USA
- View →AI/ML EngineerSan Francisco, CA, USA
- View →Creative Director, Brand MarketingNew York, NY, USA; San Francisco, CA, USA
- View →Senior Software Engineer (Chicago)Chicago, IL, USA
- View →Data Scientist, Growth ProductSan Francisco, CA, USA
- View →Senior Full-Stack Engineer, App Journey (GraphQL)New York, NY, USA; San Francisco, CA, USA
