Senior AI/ML Engineer
Chicagoonsitesenior
via Greenhouse
About this role
About the role
We’re hiring for a Senior AI/ML Engineer, Growth & Marketing AI to help us build the next generation of AI-powered growth and marketing capabilities at Chime. In this role, you’ll develop foundational transformer models that convert behavioral and financial data into highly personalized experiences, recommendations, and communications for millions of members.
You’ll work closely with the Growth & Marketing team, as well as the Product and Engineering teams to deploy scalable AI systems that improve member engagement and drive company growth. This is a highly applied role where you’ll have the opportunity to work with rich datasets, solve challenging real-world problems, and build cutting-edge deep learning systems in production.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, redis, snowflake, aws…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Chicago. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlredissnowflakeawssagemakersparkpysparkkafkaairflowpytorchteamsmaven
More at Chime
- View →Principal Product Designer, SpendingSan Francisco, CA, USA
- View →AI/ML EngineerSan Francisco, CA, USA
- View →Creative Director, Brand MarketingNew York, NY, USA; San Francisco, CA, USA
- View →Senior Software Engineer (Chicago)Chicago, IL, USA
- View →Data Scientist, Growth ProductSan Francisco, CA, USA
- View →Senior Full-Stack Engineer, App Journey (GraphQL)New York, NY, USA; San Francisco, CA, USA