B
BlueberrylabsprivatelimitedInformation Technology

PHP Developer

Hyderabadonsitemid

Posted 111mo ago · via Smartrecruiters

About this role

About Blueberry Digital Labs (www.blueberrylabs.com) is a leading young and dynamic integrated digital technology Company with a portfolio of successful websites, and a passion to carve out a niche in the competitive world of Internet. We love fun at workplace and encourage creativity sans the hierarchy based disruptions. Our belief is that we are all partners in success. Job Summary: Blueberry is seeking experienced PHP developer to join our innovative team in Hyderabad. Candidate will be working on large sized web applications using PHP, MYSQL,Aws, word press, Symphony, HTML5 & JAVASCRIPT LIBRARIES. We encourage people who can set their own direction and care about what they create. We are looking for Sernior and Junior PHP Developer.…

Read the full description on Blueberrylabsprivatelimited's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, sql, laravel, mysql…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Hyderabad. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqllaravelmysqlaws

More at Blueberrylabsprivatelimited

See all open jobs at Blueberrylabsprivatelimited