Technology Operation Engineer
Riyadhonsitemid
via Greenhouse
About this role
We don’t think about job roles in a traditional way. We are anti-silo. Anti-career stagnation. Anti-conventional.
Beyond ONE is a digital services provider radically reshaping the personalised digital ecosystems of consumers in high growth markets around the world. We’re building a digital services aggregator platform, with a strong telco foundation, and a profitable growth strategy that empowers users to drive their own experience—subscribe once, source from many, and only pay for what you actually use.
Since being founded in 2021, we’ve acquired Virgin Mobile MEA, Friendi Mobile MEA and Virgin Mobile LATAM (with 6.5 million subscribers) and 1600 dedicated colleagues across Chile, Colombia, KSA, Kuwait, Mexico, Oman, Pakistan and UAE.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, shell, rest, soap, mysql…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Riyadh. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonshellrestsoapmysqlgrafanaelkkafkateamsgreenhouse
More at Beyondone
- View →Senior Motion DesignerLahore, Punjab, Pakistan
- View →Senior GRC Security SpecialistRiyadh, Riyadh, Saudi Arabia
- View →Senior Software Engineer - I - BackendLahore, Punjab, Pakistan
- View →Senior Software Engineer I - WebLahore, Punjab, Pakistan
- View →Senior Software Engineer II - AndroidLahore, Punjab, Pakistan
- View →Senior BI EngineerBogotá, Bogotá, Colombia
