Senior Mobile Engineer, Health
United States & Canadaonsitesenior$194K – $233K
via Greenhouse
About this role
Who We Are
Babylist is the leading platform for expecting and new families. More than 10 million people shop with Babylist every year, making it the go-to destination for seamless purchasing, guidance, and expert recommendations. As a modern, AI-forward tech company, Babylist has expanded from a universal registry into a full ecosystem — the Babylist Shop, Babylist Health, Babylist Money, NYC and LA showrooms, branded content, and more — generating $750M in revenue in 2025. Building the generational brand in baby, Babylist is reshaping the $235B kids and baby market and helping parents feel confident, connected, and cared for at every step.
Our Ways of Working
Babylist is remote-first with team members across the U.S.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: ruby, kotlin, swift, rails, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in United States & Canada. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
rubykotlinswiftrailsmysqlredisawsfigmateamsoutreach
More at Babylist
- View →Showroom Shift Lead - NYC ShowroomNew York City, NY
- View →Senior Netsuite Functional LeadUnited States
- View →Senior Production ManagerUnited States
- View →Corporate Finance ManagerUnited States & Canada
- View →VP, Talent Strategy & Employer BrandUnited States
- View →Registry Specialist - NYC ShowroomNew York City, NY
