Staff Software Engineer, Data Engineering
United Statesonsitestaff
via Greenhouse
About this role
Airbnb was born in 2007 when two hosts welcomed three guests to their San Francisco home, and has since grown to over 5 million hosts who have welcomed over 2 billion guest arrivals in almost every country across the globe. Every day, hosts offer unique stays and experiences that make it possible for guests to connect with communities in a more authentic way.
The Community You Will Join:
At Airbnb, we need to ensure every area of the business has trustworthy data to fuel insight and innovation. Understanding the business need, securing the right data sources, designing usable data models, and building robust & dependable data pipelines are essential skills to meet this goal.
We are currently hiring for the following teams:…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, java, scala, sql, postgresql…
2
Level fit
This role is staff-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in United States. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonjavascalasqlpostgresqlmysqlbigqueryredshiftsparkkafkaflinkteams
